SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022686 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022686
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.1e-46
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022686   Gene: ENSMLUG00000026228   Transcript: ENSMLUT00000023597
Sequence length 199
Comment pep:novel scaffold:Myoluc2.0:GL429957:1500461:1502198:-1 gene:ENSMLUG00000026228 transcript:ENSMLUT00000023597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINGLYPEGQAPVRKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences G1QG53
ENSMLUP00000022686 XP_006096955.1.53796 ENSMLUP00000022686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]