SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90961448|ref|YP_535364.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90961448|ref|YP_535364.1|
Domain Number 1 Region: 241-263,293-652
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.36e-98
Family beta-Lactamase/D-ala carboxypeptidase 0.0000241
Further Details:      
 
Domain Number 2 Region: 69-281
Classification Level Classification E-value
Superfamily Lysozyme-like 1.18e-68
Family PBP transglycosylase domain-like 0.00000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90961448|ref|YP_535364.1|
Sequence length 714
Comment multimodular transpeptidase-transglycosylase PBP 2A [Lactobacillus salivarius UCC118]
Sequence
MKIKDFFEKIKDDFLANSRIFGSWFKKKWTRYQGWRWLTIVFLSIFFLISSYGVFLAKKT
NVRGLKSALQTSTEIYDYKGQKAGALYSQKGTWVPLDKISDNVQNAVLSTEDRNFYHEYG
FSITGIGRATLLYAKNKILHRDYISGGGSTLTQQLVKNAFLSQEQTFSRKIKEIFIAMQV
ENDYSKKDILAMYLNNAYFGNGVWGVEDAAEKYFGVHASKLSVPQAATLAGMLKSPTAYN
PIDHPQASRDRRNVVLGLMEDNKKLSAEQVSQYQATPMTTNDNYQYTSSYRYPYYFDAVI
NEAMNRYGLSETDIMNRGYKIYTSLNQNYQNEMQDDFADSSLFPYNAEDGTKAQGASIAI
NPQNGGVAAVVGGREGTHVFRGYNRGTQLVRSPGSTIKPLAVYTPALQLGYHYDTDVKDE
LKAYGKDKYEPHNWNDVYSGEIPMYQALAESKNTSAVWLLNKIGVSKGYKSVEKFGIKLT
SDDENLSLALGGLKKGVSPYQMANAYTAFANGGKLYTAHFITKIVDAQGKVIVDNTENDS
KKIMTKKIANEMTSMMMDVYRTGGTGQSASPSGYTIAGKTGSTESLTASNSSNENDHWYI
GYTPDVVVATWVGFDSTKYSLSEEGIRGGASLFKNEMEGILPHTAGNTFTVKPASTMVAQ
ESGASSSSSNVWDTFRKAGETLDDSFSKSASDWGSKASSLFDQGKQKLQEWFGQ
Download sequence
Identical sequences Q1WUQ4
gi|90961448|ref|YP_535364.1| 362948.LSL_0472 WP_011475775.1.18154 WP_011475775.1.26542 WP_011475775.1.65019 WP_011475775.1.7912 WP_011475775.1.81444 YP_535364.1.8253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]