SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90961910|ref|YP_535826.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90961910|ref|YP_535826.1|
Domain Number 1 Region: 244-266,303-670
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.42e-90
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000981
Further Details:      
 
Domain Number 2 Region: 76-286
Classification Level Classification E-value
Superfamily Lysozyme-like 1.97e-68
Family PBP transglycosylase domain-like 0.00000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90961910|ref|YP_535826.1|
Sequence length 772
Comment multimodular transpeptidase-transglycosylase PBP 1A [Lactobacillus salivarius UCC118]
Sequence
MDSNENSRLSRVAKRREEESRNNPRKPNKNSGLVKKIILGALTALLALFVIGATVFFVYA
KNAPELSENKLTSAGNSVIYDANGDKITSLGNENRTYIKTEDIPQQLKDAVVSIEDRRFY
KHHGVDPVRIVSAALSNVTGSSAGLQGGSTLDQQLIKLSFFSTKKSDQTLKRKSQEAWLA
MQLDKEYSKEQILTFYVNKVFMGYGTYGMETAAKYYYGKSLKNLDLAQTAMIAGIPNAPS
TYNPYSSPKLATQRRNDVLDAMVANKKISQAQANEAKQEDVTDGLVQTHEQESTTSQKAK
ISDSYLKEVIAEAKEKGYDPYSGNLKIYTNLDMDAQKKLYNIVNTDYYVAFPNDTMQVAT
TVVDPNNGKVIAQIGGRKTGDVTYGLNRAVQTDRSSGSTAKPVMDYAPAIEYLDWATYHA
LKDTKSYYPGTSTQLYDFDNRYKGTITMRQALIESRNVPAIRALQAVGMTKAKSFLSNLG
YDTKGLSLQNGIGLPASTLQNAAAYAAFANGGTYYEPTYIDKIETADGQVNDYSSSGKRV
MQSSTAYMITDMLKQVITSSNGSGTAANISGLYQAGKTGTTAYPSDVSGQFPSDAAMDSW
FDGYTKHYSISVWVGYDHQYEPGNYVPNNSKLAQQIYKVLMTYLSQGVSNTDWTKPSNVY
SRTINGQRELYLAGSAAPTITGKGSSSGINESSSSSSSSSSDKESSGSTSSSDEKSSGSD
SSSSASESSPSTASSTPANSSATTTTGGNNNTQNNNTPATPAGNNGGNQAGH
Download sequence
Identical sequences Q1WTL8
WP_011476055.1.7912 YP_535826.1.8253 362948.LSL_0933 gi|90961910|ref|YP_535826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]