SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962028|ref|YP_535944.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962028|ref|YP_535944.1|
Domain Number 1 Region: 204-607
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.72e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.000000797
Further Details:      
 
Domain Number 2 Region: 69-252
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.44e-36
Family Penicillin binding protein dimerisation domain 0.0000394
Further Details:      
 
Domain Number 3 Region: 605-661
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0041
Further Details:      
 
Domain Number 4 Region: 665-717
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962028|ref|YP_535944.1|
Sequence length 718
Comment penicillin binding protein 2B [Lactobacillus salivarius UCC118]
Sequence
MNTNNKRPIKERQQRMMYNRKYFGRGIFFIVLIVFIVFIGRFFRVAVGHKIYGVDLNKST
QQLYASKTEIKAKRGTIYDAANQPIAEDATTYSIYIVLSKSAVAYGKKEYLPDSQKKKAA
KVLSDNLNISYKRVLQILNPKDKNTYQVELENVGKNISLETKKKIDSYHLTGIKFTPSQS
RLYPNGVFASHLIGLAESEDKKLVGIMGLEKVFNKQLSGRDGINNTATDSYGVQLPGSSK
KKRSVQNGDDIYTTLDPKIQTALENLLTQKQKKFKAASINAVVMDSHTGKIVAASQRPTF
DAQTKEGLTNVWRNTLLEDAYEPGSTMKVLTVASAINSGNYDSNATYRSGSYVIDGSTVY
DWNRSGWGNITVKEGFMRSSNAVMAQLEQKMGKKTWMSYIRKFGLLRPVGAGLGAESSGN
INYTYAFDQANTAYGQGIDVTVIQMMQAFSAIANKGKMVKPRLVDKIVDPNTGKTVYKSK
TQVVGKPITAKTSKKVLDMMEAVVYDEKGLGKDYAIDGYKIAAKTGTAQIANSNGTGYLS
GSSNYIFSVVGMAPADNPRYIMYLTVKQPKSFGNNDATKNLSTIFNPIMKKVLDSSQVNN
TNPGTVKVENVVGNSVDDAKDKISKQGLVPVVVGSGDKVEKQSVEGDQTVISGEKVLLLT
NGTKTMPDINGWSRNDIAKLADLTGITVNYTGSGYAYYQSIAAGGALKKSDIVEVKLK
Download sequence
Identical sequences Q1WT97
gi|90962028|ref|YP_535944.1| WP_011476141.1.18154 WP_011476141.1.7912 YP_535944.1.8253 362948.LSL_1053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]