SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962063|ref|YP_535979.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962063|ref|YP_535979.1|
Domain Number 1 Region: 317-655
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.84e-55
Family beta-Lactamase/D-ala carboxypeptidase 0.0068
Further Details:      
 
Domain Number 2 Region: 64-125,185-316
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.16e-26
Family Penicillin binding protein dimerisation domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962063|ref|YP_535979.1|
Sequence length 688
Comment penicillin-binding protein [Lactobacillus salivarius UCC118]
Sequence
MKFLRSSRRNRRNSNQNSLIPFRLNFLFVIVFLLFAALIAQLAYLQIVNGQKFSSEAANN
DTYTETTNVQRGMMYDSTGKLIVGNNSSRAITYTKPLGVTNQKMRAIADELVKFVSIKTD
SLTSGMKAEYYLANVKNYDAVKEHIKNADSLDSSELNRLMITYVRKHGLVSDMANKEKEA
AIVYNKMSGAYSLSSVYIKTSGVSDTEMAEVGENLSSMPGIKIGTDWTRSYPDGTSIKNL
AGTVTTEKQGLPDDSINTFLAQGYSRNDSVGSSYLEKQYQDVLKGTKKTTKVFTQNGKIT
KEVEQYGGQAGDDVQLTINAKFQQDMQKIMDSAVAGLGGYSNGGYAVAINPHTGGIYGMA
GVYREPNTGKTTVDPAGAINQSITMGSVVKPAMIIGALKSGVITPDNNVLTDMPIKVKDT
PVKGSWFNKSGGANVALTASDALMVSSNSYMMQLAMKKAGFKYSYGATLTMPTSIFKKLR
NNFNEFGLGVRTGIDLPGEVSGLEGKSTAKYIGSALDLSYGNYDSYTTIQLAQYASILAN
KGYKIQPHLLQSIRANGKDGKMGAVKYEVKPNITGVIDVPDSYWDIIHSGMYKVVHGTSQ
YATGTAMKDINPAIAAKTGTAETVYKNTDTITLSAISYAPYDDPQVVVVVAFPNLASDKS
SVNMNTLKSIYEAYWKDVQSSDGYKTSK
Download sequence
Identical sequences Q1WT55
WP_011476158.1.18154 WP_011476158.1.7912 YP_535979.1.8253 gi|90962063|ref|YP_535979.1| 362948.LSL_1088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]