SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962503|ref|YP_536419.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962503|ref|YP_536419.1|
Domain Number 1 Region: 6-301
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.99e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.00000978
Further Details:      
 
Weak hits

Sequence:  gi|90962503|ref|YP_536419.1|
Domain Number - Region: 322-378
Classification Level Classification E-value
Superfamily Penicillin-binding protein associated domain 0.00451
Family PBP5 C-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90962503|ref|YP_536419.1|
Sequence length 384
Comment D-alanyl-D-alanine serine-type carboxypeptidase [Lactobacillus salivarius UCC118]
Sequence
MKKQFKNWLILVMLGIAIITGSGIIRGVEADKIDAKAAYMIDAGTGQVLYQQNANSKYPI
ASLTKILTLAVIMKDIHNQKLSWNQKIKVNKDVSDMANNWQYSNVQLNEGESYTVKSLVE
SMMIVSADGSTEALALVDAGSVQAFNEKMKEVAHEAGVTDAEIYNMIGLPNSDLGNLKLK
NVGDDQENKFSAKDIALISKYLVNNYPEVIDITKQKNVDFKISADQTYNMENINYMLEGS
YAAPKNGTIDGLKTGFTDEAGYCFVGTGTFNGQRVITVILNASDYNKQFSETNKMIESVM
NNDKVVNTKDIKSVKQALKKEKLKVNDTNIWVTKNTDPKQIKAKLTLSNEKIKAKNAKNE
KVGTIKISSSGVSSVELNVNLEAK
Download sequence
Identical sequences Q1WRZ3
362948.LSL_1532 WP_011476403.1.18154 WP_011476403.1.48238 WP_011476403.1.48449 WP_011476403.1.50761 WP_011476403.1.63042 WP_011476403.1.6417 WP_011476403.1.7912 YP_536419.1.8253 gi|90962503|ref|YP_536419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]