SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56707155|ref|YP_163785.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56707155|ref|YP_163785.1|
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000576
Family HxlR-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56707155|ref|YP_163785.1|
Sequence length 68
Comment cinnamoyl ester hydrolase-like protein [Lactobacillus salivarius UCC118]
Sequence
MPNCSRRMLSLQLNELEKDKIIEKKIYPVIPPKTEYRMTRFGETLTPIILEMDKWGQTYN
SINSEDSN
Download sequence
Identical sequences A0A3E2
362948.LSL_2007 WP_011241759.1.96514 YP_163785.1.8253 gi|56707155|ref|YP_163785.1| gi|56707155|ref|YP_163785.1|NC_006530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]