SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90961021|ref|YP_534937.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90961021|ref|YP_534937.1|
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.91e-21
Family MarR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90961021|ref|YP_534937.1|
Sequence length 149
Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MSITKDEVQTLTSRLDLLIAKGAREYKDWNQKHGLTDYRSVILYELLLHTRLTQKQIVER
TNLPKQSINKGILQLRDEGYLTLEQDEKDNRVKYCFLTEEGEEYARVKIQPLLDIEEKII
MKMGKKKIEQLNELLEEWNLNFKKYKDEE
Download sequence
Identical sequences A0A255VHT0 C2EHT2 Q1WVT1
WP_003701464.1.18154 WP_003701464.1.54512 WP_003701464.1.6417 WP_003701464.1.65019 WP_003701464.1.69932 WP_003701464.1.77078 WP_003701464.1.7912 WP_003701464.1.81444 WP_003701464.1.91721 WP_003701464.1.96920 WP_003701464.1.97660 YP_534937.1.8253 362948.LSL_0031 gi|90961021|ref|YP_534937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]