SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90961789|ref|YP_535705.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90961789|ref|YP_535705.1|
Domain Number 1 Region: 9-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.37e-24
Family HxlR-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90961789|ref|YP_535705.1|
Sequence length 115
Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MPVDTENKYTLCPKFTKTFGILGRKWNGLIIEVLLEKGPQRFRNLADSVDKCSDRVMVER
LKELEDEGLVERMAQPGSTRVLYKLTPQGEDLKEIMSDIHKWSDKWYSVEDCANS
Download sequence
Identical sequences A0A089QBP7 A0A0F7PXR2 A0A2A7QNT6 A0A2A7RCT3 F7QVK0 Q1WTZ0 V6DJ24
362948.LSL_0812 gi|90961789|ref|YP_535705.1| WP_003704358.1.11218 WP_003704358.1.14256 WP_003704358.1.18154 WP_003704358.1.24464 WP_003704358.1.2488 WP_003704358.1.26542 WP_003704358.1.26735 WP_003704358.1.27104 WP_003704358.1.34351 WP_003704358.1.42466 WP_003704358.1.48238 WP_003704358.1.48449 WP_003704358.1.50761 WP_003704358.1.54215 WP_003704358.1.61399 WP_003704358.1.62422 WP_003704358.1.62947 WP_003704358.1.63042 WP_003704358.1.63458 WP_003704358.1.6417 WP_003704358.1.65019 WP_003704358.1.65843 WP_003704358.1.7912 WP_003704358.1.81444 WP_003704358.1.86350 WP_003704358.1.90868 WP_003704358.1.94487 WP_003704358.1.99703 YP_535705.1.8253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]