SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90961851|ref|YP_535767.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90961851|ref|YP_535767.1|
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.96e-18
Family MarR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90961851|ref|YP_535767.1|
Sequence length 143
Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MKSTKENLLIVSKSYQALLQKRAKQVNLTVAEWQLLRLIVEGYNTQQLLAENTNLDVSTL
SRQLSRLDAKRLIKKEVIRTEEKIRSRPASSYSLNEAGQASLDKMNQKFEELNQQIFEHW
TDEEDNLLKILLNRLATRLQQIN
Download sequence
Identical sequences A0A0F7PT06 A0A1D7TSE6 A0A2A7QPL7 A0A2A7RAX2 C2EFF3 F5VFJ0 F7QVE6 H7FZP4 Q1WTS1
362948.LSL_0874 WP_003700220.1.11218 WP_003700220.1.14256 WP_003700220.1.15614 WP_003700220.1.17280 WP_003700220.1.18154 WP_003700220.1.18878 WP_003700220.1.24464 WP_003700220.1.2488 WP_003700220.1.25927 WP_003700220.1.26542 WP_003700220.1.26735 WP_003700220.1.27104 WP_003700220.1.34351 WP_003700220.1.38084 WP_003700220.1.42466 WP_003700220.1.4481 WP_003700220.1.48238 WP_003700220.1.48449 WP_003700220.1.50761 WP_003700220.1.54215 WP_003700220.1.54512 WP_003700220.1.59320 WP_003700220.1.61399 WP_003700220.1.62422 WP_003700220.1.62947 WP_003700220.1.63042 WP_003700220.1.63458 WP_003700220.1.6417 WP_003700220.1.65019 WP_003700220.1.672 WP_003700220.1.68358 WP_003700220.1.69932 WP_003700220.1.72086 WP_003700220.1.76244 WP_003700220.1.76636 WP_003700220.1.77078 WP_003700220.1.7912 WP_003700220.1.81444 WP_003700220.1.84698 WP_003700220.1.88204 WP_003700220.1.90376 WP_003700220.1.90868 WP_003700220.1.91721 WP_003700220.1.94487 WP_003700220.1.97660 WP_003700220.1.99703 YP_535767.1.8253 gi|90961851|ref|YP_535767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]