SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962292|ref|YP_536208.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962292|ref|YP_536208.1|
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.64e-30
Family Penicillinase repressor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962292|ref|YP_536208.1|
Sequence length 148
Comment CopAB ATPases metal-fist type repressor [Lactobacillus salivarius UCC118]
Sequence
MLEKVEISNAEWDVMRVIWALGETTSRQIIEALSDRRQWKPATTKTLIGRLVAKGYVGTR
RKGRAYIYYPIIKEQQTINEQILTSFGNICQMHVGQTLATVLNNVELSKDDIKKLESILE
VKAKNAPESLPCNCVPNGSCDCMMEMDN
Download sequence
Identical sequences A0A1D7TRB5 A0A2A7QQD5 A0A2A7RB44 F5VCH2 H7G0T4 Q1WSK4 V6DKQ3
gi|90962292|ref|YP_536208.1| 362948.LSL_1318 WP_003705203.1.11218 WP_003705203.1.14256 WP_003705203.1.15614 WP_003705203.1.17280 WP_003705203.1.18878 WP_003705203.1.25927 WP_003705203.1.26735 WP_003705203.1.34351 WP_003705203.1.42466 WP_003705203.1.4481 WP_003705203.1.48449 WP_003705203.1.54512 WP_003705203.1.61399 WP_003705203.1.62947 WP_003705203.1.63458 WP_003705203.1.6417 WP_003705203.1.65019 WP_003705203.1.65843 WP_003705203.1.672 WP_003705203.1.69932 WP_003705203.1.76244 WP_003705203.1.76636 WP_003705203.1.77078 WP_003705203.1.7912 WP_003705203.1.81444 WP_003705203.1.88204 WP_003705203.1.90376 WP_003705203.1.90868 WP_003705203.1.91721 WP_003705203.1.94487 WP_003705203.1.97660 WP_003705203.1.99703 YP_536208.1.8253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]