SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962421|ref|YP_536337.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962421|ref|YP_536337.1|
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.53e-32
Family FUR-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962421|ref|YP_536337.1|
Sequence length 143
Comment ferric uptake regulation protein [Lactobacillus salivarius UCC118]
Sequence
MTLVKEAISILKEHNLKITKQRQALLEYLSNYQHRYVDITQVDKYMHTLFPGMSHNTIYR
NIKDFDNLGIIETQEKPSGACVKYQCDFGNLHHHHFICEKCGKVEEINLCPLNDLLQTQL
PGYQIDGHRFEVYGVCDKCRKNS
Download sequence
Identical sequences A0A1V9SYS4 Q1WS75
gi|90962421|ref|YP_536337.1| 362948.LSL_1450 WP_004563840.1.11218 WP_004563840.1.18154 WP_004563840.1.24464 WP_004563840.1.2488 WP_004563840.1.27104 WP_004563840.1.42466 WP_004563840.1.54215 WP_004563840.1.63458 WP_004563840.1.7912 WP_004563840.1.94487 WP_004563840.1.99703 YP_536337.1.8253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]