SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962477|ref|YP_536393.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962477|ref|YP_536393.1|
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.31e-33
Family HxlR-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|90962477|ref|YP_536393.1|
Sequence length 103
Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MKIDPQFCRVDDGLDTILGKWKIPIILYLLKNQTMRFSDLQKVLPEISKKMLSKNLKELE
EDDLITRTVYPTVPPKVEYSLTEHGKELEDIIDSLHKWGLRHQ
Download sequence
Identical sequences Q1WS19
gi|90962477|ref|YP_536393.1| WP_011476381.1.18154 WP_011476381.1.7912 YP_536393.1.8253 362948.LSL_1506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]