SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962586|ref|YP_536502.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962586|ref|YP_536502.1|
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.39e-18
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962586|ref|YP_536502.1|
Sequence length 122
Comment GntR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MLHFNFNSTEPIYLQVANQLEEAIFTKAFLDGTQVPSTTEISKEFHINPATVLKGMNILV
NDGLLEKRRGLGMFVTEGAYMKLLERRKESFYQDYIVKMIQEAKKLGMNEDDLIELVKRG
VD
Download sequence
Identical sequences A0A1V9S5M2 A0A2A7QSS0 A0A2A7RDQ5 C2EGS9 F5VDG1 H7FZ35 Q1WRR0 V6DIX9
WP_003701043.1.11218 WP_003701043.1.15614 WP_003701043.1.18154 WP_003701043.1.18878 WP_003701043.1.24464 WP_003701043.1.2488 WP_003701043.1.25927 WP_003701043.1.26735 WP_003701043.1.34351 WP_003701043.1.38084 WP_003701043.1.42466 WP_003701043.1.48238 WP_003701043.1.48449 WP_003701043.1.50761 WP_003701043.1.54215 WP_003701043.1.54512 WP_003701043.1.59320 WP_003701043.1.61399 WP_003701043.1.62422 WP_003701043.1.62947 WP_003701043.1.63042 WP_003701043.1.63458 WP_003701043.1.65019 WP_003701043.1.65843 WP_003701043.1.672 WP_003701043.1.69932 WP_003701043.1.72086 WP_003701043.1.76244 WP_003701043.1.76636 WP_003701043.1.77078 WP_003701043.1.7912 WP_003701043.1.81444 WP_003701043.1.84698 WP_003701043.1.88204 WP_003701043.1.90376 WP_003701043.1.91721 WP_003701043.1.94487 WP_003701043.1.96920 WP_003701043.1.97660 WP_003701043.1.99703 YP_536502.1.8253 gi|90962586|ref|YP_536502.1| 362948.LSL_1617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]