SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962651|ref|YP_536567.1| from Lactobacillus salivarius UCC118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962651|ref|YP_536567.1|
Domain Number 1 Region: 10-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.03e-31
Family HxlR-like 0.0000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|90962651|ref|YP_536567.1|
Sequence length 118
Comment MarR family transcriptional regulator [Lactobacillus salivarius UCC118]
Sequence
MTKKIYNIGVEATMDVIGGKWKPIILCNLRHQSLRTSELKRLIPNISQKMLTQQLRELEA
ADIINRKVYNQVPPKVEYSLSDYGQSLSTVLSDLCTWGEMHVDMLKKRGEDVELVNYD
Download sequence
Identical sequences A0A0F7PVJ0 A0A1V9S6H6 Q1WRL4
362948.LSL_1682 WP_011476515.1.11218 WP_011476515.1.14256 WP_011476515.1.15614 WP_011476515.1.18154 WP_011476515.1.24464 WP_011476515.1.26735 WP_011476515.1.34351 WP_011476515.1.38084 WP_011476515.1.42466 WP_011476515.1.48238 WP_011476515.1.48449 WP_011476515.1.50761 WP_011476515.1.54215 WP_011476515.1.59320 WP_011476515.1.63042 WP_011476515.1.63458 WP_011476515.1.65019 WP_011476515.1.76636 WP_011476515.1.7912 WP_011476515.1.81444 WP_011476515.1.88204 WP_011476515.1.94487 WP_011476515.1.99703 YP_536567.1.8253 gi|90962651|ref|YP_536567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]