SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71277811|ref|YP_271623.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71277811|ref|YP_271623.1|
Domain Number 1 Region: 1-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.73e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000686
Further Details:      
 
Domain Number 2 Region: 340-454
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.09e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71277811|ref|YP_271623.1|
Sequence length 454
Comment glutathione reductase [Colwellia psychrerythraea 34H]
Sequence
MTQHFDYLAIGGGSGGIASANRAAKLGKKAAVIEAKYIGGTCVNVGCVPKKAMWYAGQIS
DALKYASDYGFAQHLTQDTPQFDWAKLVANREAYIERIHAAYQRGFDANDVTVIDGFAKF
VDKNTVEVNGELITADHITIATGGRPTLPNIEGADYGIDSDGFFALTEQPKSVAVVGAGY
IAVELAGVFHALGTKAHLLVRKEKPLRGFDNMLSDTLVEQMAKHGPTLHNHSTPERIEKL
ADGSLVIHLTNGKTIGPVETLVWAIGREPATDNINLAAAGVAMNERGFIETDKYQNTNVD
GIYAVGDNTGRAQLTPVAVAAGRRLCERLFNNKPEEHLDYSGIATVVFSHPVIGTVGLTE
NEAIAQYGEENITVYKSQFTALYQAITEDHRDPTRMKLICAGKEEKVVGLHSIGFGSDEL
LQGFAVAMKMGATKADFDNTIAIHPTSAEEFVTM
Download sequence
Identical sequences Q47UA0
gi|71277811|ref|YP_271623.1| 167879.CPS_4984 WP_011045703.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]