SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278420|ref|YP_267100.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278420|ref|YP_267100.1|
Domain Number 1 Region: 1-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.002
Further Details:      
 
Domain Number 2 Region: 346-463
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.19e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71278420|ref|YP_267100.1|
Sequence length 466
Comment soluble pyridine nucleotide transhydrogenase [Colwellia psychrerythraea 34H]
Sequence
MEKSFDYDVIIIGTGPGGEGAAMNLAKRQKKVAIIERYHQVGGGCTHWGTIPSKALRQSV
SRLIEYNSNPLFNQNEQVKQLTFQDILSHASAVIQKQVSLRSGFYNRNRVEHIQGQASFI
DAHTISISHPDGSVEKISAKQIMIATGSRPYRPDDIDFDHPRVYDSDSILSLKHAPQHVI
IYGAGVIGSEYASIFRGLGVKVDLINTRERLLSFLDTEMSDSLSYHLWNSGVVIRHGEEI
ERVESSEDAVIVHLKSGKKMRADCLLFANGRTGNTADLNLAAAGLKADGRGQLKVNDCYQ
TEVDNIFAVGDVIGYPSLASAAFDQGRIAASAMVDSSSKAKLIVDIPTGIYTIPEISSVG
KTEQELTEAKIPYEVGRAQFKHLARAQISNNLVGSLKILFHRETKEILGIHCFGENAAEI
IHIGQAIMQQTNGGNTIEYFVETTFNYPTMAEAFRVAALNGLNRLF
Download sequence
Identical sequences Q48A14
WP_011041207.1.15195 167879.CPS_0334 gi|71278420|ref|YP_267100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]