SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278707|ref|YP_269751.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278707|ref|YP_269751.1|
Domain Number 1 Region: 15-313,463-523
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.72e-60
Family FAD-linked reductases, N-terminal domain 0.049
Further Details:      
 
Domain Number 2 Region: 294-464
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000184
Family GMC oxidoreductases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71278707|ref|YP_269751.1|
Sequence length 528
Comment oxidoreductase [Colwellia psychrerythraea 34H]
Sequence
MTNIAKFDLDDDDLVVIIGSGAGGGTVANELAQKGVRSVVLEAGKRFTLEDLKNSEWEMF
MKLSWLDKRISAGGWHHAKNHSGLPAWIVKGVGGSSIHWAGVSLRFKPHEFKMKSTNGVI
EGANVADWPISYDDIAPYYEKAEDKMGVTGTKATGTPDLPENSHTKLHRVAAERTGMTFS
NAPMAINSVARDGRPACQQIGFCMQGCRIGAKWSTMYTEIPKAEATGLCEIRPNSMVLKI
EHDEDGRASGVHYVDENGNKKLQKARIVCVAGNSIESPRLLLNSASKKFPDGLANSSGQV
GRNYMGHVTGGVYGVFPKPVNMHRGTSVPSLITSEQRNDPDRGFVAGYSLEVLSLGLGFL
SAFLKPGTSGWGREVSEALENYQNMAGVWICGEDLPVETNRITLHPTEKDQNGLPVPVIT
KTDHNNDLVMRNHAYAQTAKLYKSVGATKLHNLPAYPNSHNMGTNRMSEKASDGVVNKWG
QSHDVPNLFISDGSQFVTSAAVNPTLTIVALAIRQAEHIAKLVKTNAL
Download sequence
Identical sequences Q47ZL9
167879.CPS_3053 gi|71278707|ref|YP_269751.1| WP_011043840.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]