SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278714|ref|YP_270688.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278714|ref|YP_270688.1|
Domain Number 1 Region: 107-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-35
Family Reductases 0.064
Further Details:      
 
Domain Number 2 Region: 12-118
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 7.58e-27
Family Ferredoxin reductase FAD-binding domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 243-364
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8e-26
Family 2Fe-2S ferredoxin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71278714|ref|YP_270688.1|
Sequence length 365
Comment oxidoreductase, FAD/NAD-binding/iron-sulfur cluster binding protein [Colwellia psychrerythraea 34H]
Sequence
MINTSQYSVNTQTWTNGRHDVQCVKVIDETIDARTYCFTSTEPVMHFFKPGQFVTLELEI
DGMQVLRSYTISSSPSVPYSFSITVKRMPGGQVSNWLHDNLKQGDQIAVHGPVGIFNCID
ITAEKVLLLSGGVGITPVMSMARWWFDTNGDVDMVFAHSARTPKDIIYRRELEYMDSRIT
NFNLNFICERYDIGDSWSGFCGFFDEQKLRMIAPDFLDRTIYCCGPTPYMTAVKSMLQNI
GFDMANYHEESFGAPPEEAQLDAEQQMEDAAGESIDDDTLIEVAFSKTGKSVKIQPGGTV
HLAASQVGLHIPKACGMGICGTCKVKKIHGEVIMSHNGGITDEDVADGYILSCCSVPQGD
VSVEY
Download sequence
Identical sequences Q47WY3
gi|71278714|ref|YP_270688.1| 167879.CPS_4030 WP_011044774.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]