SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278850|ref|YP_271404.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278850|ref|YP_271404.1|
Domain Number 1 Region: 153-351
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000328
Further Details:      
 
Domain Number 2 Region: 441-577
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000238
Further Details:      
 
Domain Number 3 Region: 18-149
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.6e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.00032
Further Details:      
 
Domain Number 4 Region: 353-435
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71278850|ref|YP_271404.1|
Sequence length 584
Comment sulfite reductase subunit beta [Colwellia psychrerythraea 34H]
Sequence
MSNNFTKVENPVLIVEGKQADNERLKAESDYLRGTIKDDLQDRMTGGFTSDNFQLIRTHG
MYQQDDRDIRAERQKQKLEPLHNVMLRARLPGGIINPTQWLAIDKFADDYTSYGSIRLTT
RQTFQFHGVLKPNIKLMHQTLNSVGLDSIATAGDVNRNVLCTSNPVESALHQEAYEWATK
ISEHLLPKTRAYAEIWLDEEKVETTEADEIEPILGSNYLPRKFKTTVVIPPNNDIDVHAN
DLNFVAISEGGELIGFNVLVGGGLAMTHGDKATYPRCADDFGFIPKEHTLAIAAAVVTTQ
RDWGNRVNRKNAKTKYTLDRVGVDTFKAEVERRAGIKFSESRSYEFTHRGDSFGWVEGID
GKNHLTLFIENGRILDFNGANSDSKALKTGMREIAKIHKGDFRLTANQNLIVAGVSAEDK
TIIEQLAREHGLINDGVSNQRKSSMACVAFPTCPLAMAEAERYLPGLVDDVEAILEKNGL
KDDSIILRVTGCPNGCGRAMLAEIGLVGKGPGKYNMYLGSDLAGSRVPKLYKENVDEAGV
LSEIDALSARWSAERNDGEAFGDFVIRAGIVEQVIVSFRDFHHA
Download sequence
Identical sequences Q47UW8
WP_011045485.1.15195 gi|71278850|ref|YP_271404.1| 167879.CPS_4760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]