SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278923|ref|YP_269612.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278923|ref|YP_269612.1|
Domain Number 1 Region: 100-302,500-552
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.66e-25
Family HI0933 N-terminal domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  gi|71278923|ref|YP_269612.1|
Domain Number - Region: 337-403
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 0.0536
Family GyrA/ParC C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71278923|ref|YP_269612.1|
Sequence length 561
Comment hypothetical protein CPS_2911 [Colwellia psychrerythraea 34H]
Sequence
MIRLTNIKLPLDHQEHELEQAILTKLSIKAVQLIKFTVFKRGYDARKKNSIFLIYTLDVE
TNVDEALLATFIADTQVKETPDMAYKFVSQAPKNLKNRPVVIGMGPCGLFVGLVLAQMGF
NPIVLERGQEVRQRTKDTFGFWRKKILNTESNVQFGEGGAGTFSDGKLYSQVKDPKHYSR
KVLHEFVAAGAPEEILYVSKPHIGTFKLVTMVEKMRAKIFELGGEVRFNQRVDKIHFTDV
EGNECTAQGIEGYQNKKVTGLTLSNGDHIETNYIALAIGHSARDTFSMLFDEDVYMKAKP
FSVGFRIEHEQAVIDEARFGNNAGNEILGSADYKLVHHCSNGRSVYSFCMCPGGTVVAAA
SEEGRLVTNGMSQYSRLERNANSAIVVGIEPEDFITSEFASDRDYVLAGMEFQRNLEAKA
FKLGGESYDAPVQLVGDFLAGRKSGEHGSVAPSYKPGVTYCDLSETLPDYAIAAIREALP
AFDKKIKGFSMAEATLTAVETRTSSPIQITRDKETLQSLNAQGLYPAGEGAGYAGGILSA
GIDGIKIAEAMALAITAEQEH
Download sequence
Identical sequences Q480A7
CsR84 WP_011043704.1.15195 gi|71278923|ref|YP_269612.1| 167879.CPS_2911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]