SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71279427|ref|YP_268942.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71279427|ref|YP_268942.1|
Domain Number 1 Region: 5-259,359-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000000313
Further Details:      
 
Domain Number 2 Region: 453-588
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.07e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 236-355
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.27e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71279427|ref|YP_268942.1|
Sequence length 588
Comment succinate dehydrogenase flavoprotein subunit [Colwellia psychrerythraea 34H]
Sequence
MSVPIREFDAIVIGAGGAGMRAALAISESGKSCALISKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDYIGDQDAIEYMCKTGPESIIELEKMGLPFSRTEEGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKNKTNVYSEWYALDLVKNSDGAVVGT
TAICIETGEIVYFKARATVLATGGAGRIFASTTNAHINTGDGVGMSLRAGIQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCDGPWGPHIKLKLDHLGRETLYKRLPGVCDLSKTFAHVDPAEEPIPVIPTCHYQMGGV
PCNVNGQALNIGSDGKETIVEGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGNFLG
TYLNETQTATEASESDLEAALARTNRWESSTKGEDPVQIRKDLQMCMQMNFSVFREGEAM
AQGMKELTEIRERLSDARLDDKSSEFNTQRIECLELDNLMETAFCSAKAANFRTESRGAH
ARQDFTERDDVNWLCHSVYTPETEEMTKRDVNMKPVHREAFPPKARVY
Download sequence
Identical sequences Q482S5
gi|71279427|ref|YP_268942.1| WP_011043036.1.15195 167879.CPS_2217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]