SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71280188|ref|YP_267027.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71280188|ref|YP_267027.1|
Domain Number 1 Region: 15-64,140-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.42e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 
Weak hits

Sequence:  gi|71280188|ref|YP_267027.1|
Domain Number - Region: 340-416
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.0314
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71280188|ref|YP_267027.1|
Sequence length 495
Comment hypothetical protein CPS_0260 [Colwellia psychrerythraea 34H]
Sequence
MNKTSKAYQPLLSSKAKIAIIGGGVAGSTIALRFAELGLDTTLIEKGPSLVNGPPICHLH
AGGNLYREICDEQCLTLLKQSIDTVKVYPQSVNIRPTVIALPKTDNGQPEDLLPRLEKLR
AKYSELVAQDSRNKVLGEPENYFKFYSRTELDALLDLPLPKTAKNDSDWLVAFAQHVDLD
SLKFPVLLVQEYGLSAFRFAAIASLAIEGLPSCHLQTNKQVIAIVQQKNSLGWQVSTQAL
PQHQQSPTIIHQHFDYVINACGFKSGEIDDMVSAKRKRMVEFKAAYVAHWPQCQGLWPEI
VFYGERGTPQGMAQLTPYPDGYFQLHGMTQDITLFDQGLVASSLESAQPQLAKRFIEKID
KKWPEQLVHNRTLGSIEHIAQFISAFSSAEVAAKPLFGAQQIPGEDADLRAADVSFYGQH
YARAEIVKASSALAAGDAILKNLVDCGLIAALELGRYLTEHYFPVSQQCSEIEVTERAIM
LAKQREYPIALAKNL
Download sequence
Identical sequences Q48A86
167879.CPS_0260 CsR142 gi|71280188|ref|YP_267027.1| WP_011041134.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]