SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71280229|ref|YP_267674.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71280229|ref|YP_267674.1|
Domain Number 1 Region: 4-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.37e-110
Family FMN-linked oxidoreductases 0.00000000506
Further Details:      
 
Domain Number 2 Region: 336-525
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.18e-35
Family N-terminal domain of adrenodoxin reductase-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 472-635
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.39e-18
Family C-terminal domain of adrenodoxin reductase-like 0.0000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71280229|ref|YP_267674.1|
Sequence length 680
Comment 2,4-dienoyl-CoA reductase [Colwellia psychrerythraea 34H]
Sequence
MTTTAYPHLLAPLDLGFTQLANRVLMGSMHTGLEEERGGFAKLAAFYQARAKGGVGLIVT
GGVSPNLRGRIAPFGSELSHFWQANKHKQVTDAVHQYPTKICLQLLHTGRYAYHPFGVAP
SKIKSPISPFTPKAMSVRQIKSTIKDYAYSAKLAAKAGYDGVEIMGSEGYLINQFACVRT
NKRNDEWGGSIENRMRLAIETIKAVRAKVGENFIIIFRLSMLDLVEGGNSWEEVVTMAKA
VEQAGATLINTGIGWHEARVPTIVTSVPRAAFTWVTEKMKKEVSIPLITTNRINTPEVAE
EVLATGQADMVSMARPFLADADFVNKAAENKADEINTCIGCNQACLDHVFAQKRASCLVN
PMACYETELVIEKAKQVKKLAVIGAGPAGLAFSVYAAERGHHVELFDKISEIGGQFNVAK
QVPGKEEFFETLRYFNKQISLLDIKVYLNTEQSAEKLLAAGFDEVVLATGIKPRKLDIKG
LEEGYTSNKVLTYLQVLRDKVEVGNKVAIIGAGGIGFDVATYLSEKSLTNDPEAWLKNWG
VDKQYLKNGALLSKQDIPKHDPARHITLIQRKTTKVGKGLGKTSGWVHRANLVKQGVTML
AGASYKAITEKGLVIEVDGKEQLLEVDNIIICAGQESNRDLQQKLIDGGLPVHLIGGANV
AAELDAKRAIRQAAELAVKI
Download sequence
Identical sequences Q487U1
WP_011041768.1.15195 167879.CPS_0925 gi|71280229|ref|YP_267674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]