SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71280483|ref|YP_268776.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71280483|ref|YP_268776.1|
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 
Domain Number 2 Region: 168-228,259-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000839
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  gi|71280483|ref|YP_268776.1|
Domain Number - Region: 231-261
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0432
Family Tyrosine-dependent oxidoreductases 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71280483|ref|YP_268776.1|
Sequence length 419
Comment hypothetical protein CPS_2048 [Colwellia psychrerythraea 34H]
Sequence
MTIEKIDTLVIGAGQAGVAMSEHLSKQDVPHLVLERNRIAEQWRTGRWDSLVANGPAWHD
RFPGLEFEEHDPDSFVPKEKIADYLVDYAKKFDAPIRTGIEVKNVERNTNGQGFIIETSQ
GTIEAKRVVSATGPFQVPVIPPIAKNEKITQIHSADYRNPEQLEDGAVLVVGAGSSGVQI
ADELQRSGRKVFLSTGPHDRPPRSYRNRDFCWWLGVLGEWDRESLEPGTEHVTIAVTGAH
GGNGTVDFRALAHQGITLLGMTKEFNNGKVTFQKDLNTNVERGNKNYMDFLDSADAYIER
NGLDLPEEPTARDVLSDPECMTNPILELDLAKEGITSIVWATGFALDYSWLNVDAFDENG
KPAHQRGVSTEPGVYFVGQAWLSRRGSAFIWGVWHDAKHIAGHISTQRTYSAYQDASQR
Download sequence
Identical sequences Q483J0
CsR144 167879.CPS_2048 gi|71280483|ref|YP_268776.1| WP_011042870.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]