SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71281441|ref|YP_267880.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71281441|ref|YP_267880.1|
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.14e-30
Family 2Fe-2S ferredoxin-related 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71281441|ref|YP_267880.1|
Sequence length 112
Comment ferredoxin, 2Fe-2S [Colwellia psychrerythraea 34H]
Sequence
MPKIIFLPNEELCPDGAVVEAEKGESVLNVALRNDIGIEHACEKVCACTTCHIIIREGFD
SIEEGDELEEDMLDKAWGLEPESRLSCQSIVGDEDLVVDIPKYTVNMVSETH
Download sequence
Identical sequences Q486Y5
167879.CPS_1137 gi|71281441|ref|YP_267880.1| WP_011041974.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]