SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71282146|ref|YP_267006.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71282146|ref|YP_267006.1|
Domain Number 1 Region: 9-96,156-263,352-459
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-30
Family FAD-linked reductases, N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71282146|ref|YP_267006.1|
Sequence length 537
Comment tryptophan halogenase [Colwellia psychrerythraea 34H]
Sequence
MHIMNKLTKTVVIVGGGIAGWLTAGRLAAKHKSNTEQGLNVILIESANIPAVGVGEGTWP
TMRSTLRALGISESDFIRECEASFKQGAKFAKWFDGTEDDFYYHPLVLPQGFGKTDLAAH
WLAKQTQTKQKNSHVNSFSNEVCYQEAICEQGLAPKTIRHAEFSDVANYAYHLDSAKFAV
FLQKHCQEKLGVTHIVDDVTGVNCDVNRADKDIIDETIDKGDILSVSTQNHGDIAGELFV
DCTGFSSLLLGKHYQVPFKKCDDILFIDTALAVQVPYDSKDSPIASHTISTGQKAGWIWD
IGLQHRRGVGYVYSSKHSTEAEARAVLAEYVGDKFSSLNVRKIPIVSGHREKFWQNNCVA
VGLSAGFLEPLEASALVMVELAAQMISEQLPASREVMDVVAKRFNETALYRWDRIIDFLK
LHYILSERTEPFWTDNRESATIPQSLQDLMTEWKYRSPADHDFTSNNEVFPAASYQYVLY
GMGFKSDYCHTPYAFDDCDFADGQFKQNKVLIDKALSSLPSNRELLDKIKSYGFSRI
Download sequence
Identical sequences Q48AA7
gi|71282146|ref|YP_267006.1| WP_011041113.1.15195 167879.CPS_0239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]