SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71282300|ref|YP_266877.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71282300|ref|YP_266877.1|
Domain Number 1 Region: 1-318,508-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-57
Family FAD-linked reductases, N-terminal domain 0.046
Further Details:      
 
Domain Number 2 Region: 412-496
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000122
Family GMC oxidoreductases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71282300|ref|YP_266877.1|
Sequence length 573
Comment hypothetical protein CPS_0109 [Colwellia psychrerythraea 34H]
Sequence
MSYDICIIGSGAGASPIAHQLSKAGAKVLVLEKGPWLTEKEFFKDELTISIHDAYNPKLT
DEQHVIEEEYFDENDKPFWQGEKTSDSGWSWWNGNVVGGSSNFMSGYFHRLKPIDFRLKS
EFGAISGANVEDWPISYDELEPYYAKVEREVGVSGRVVEHPHQEPRSTDFPYPPIAELPM
SSWIDKAAQKIGYHAIPVPRAILSKPAMGRRSCEYSGYCSSYGCASGAKGSGRAALLNNA
VASGNCTIQANAKVYKIATDKQGEITGVHYYDKIGRKKSVTAKIYVVACQAVETSRLLLA
STGEKFPQGLANNNGQVGKNLLFSGGGTGQGDFNYADLSDKQVGELKQVGPFINRALQDW
YQIADKSFTGANAKGQAKGGTIDFLFHQNPIARARGTQWGSDQNGDDKLLWGEDLKQSLK
TEFTSYKTLRFEVFNDWLPTDDCFVSLDNEVTDQWGDPVAKVRIGYHDHDLEVGEYLSKK
AEKLLEALGAKNVSSSVSGYPSTNLMAGGCRFGNDPKTSVLNKTCQAHEVDNLYVTDGSF
MPTGGSVPYTFTIYANAFRVADKIKAHWLTLKS
Download sequence
Identical sequences Q48AN6
167879.CPS_0109 gi|71282300|ref|YP_266877.1| WP_011040984.1.15195 CsR150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]