SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71282357|ref|YP_270785.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71282357|ref|YP_270785.1|
Domain Number 1 Region: 4-253,354-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.43e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000778
Further Details:      
 
Domain Number 2 Region: 236-351
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.24e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 423-520
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 4.19e-31
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71282357|ref|YP_270785.1|
Sequence length 532
Comment L-aspartate oxidase [Colwellia psychrerythraea 34H]
Sequence
MTQQNNCDVLIIGSGAAGLTLALHLAQNADVVILSKGPLNEGSTFYAQGGIAAVFDENDS
VASHVEDTIVAGAGLCDEDTVRFTTENAKSCLEWLIDQGVEFDKEQSSKGESRYHLTREG
GHSHRRILHSADATGQAIQTTLADQVRQHSRIRIFERFNAIDLICQASTTGNQPKQCIGA
YIWNRNTEKVESIYAQKTILATGGASKVYQYTSNPDVASGDGIAMAWRAGCRVANMEFNQ
FHPTCLFHPSAGTFLLTEALRGEGAKLRRPDGSRFMPAFDERAELAPRDIVARAIDYEMK
RLGADCMYLDISHKPSDFIKQHFPTIYEKTMSLGIDITKQPIPIVPAAHYTCGGVMVDHQ
GKTDISQLYAIGEMSYTGLHGANRLASNSLLECLVFARAAAIEIGETLVQSNHYLTLPHW
DDSRVTDSDEEVVIQHNWHELRLFMWDYVGIVRTTKRLERALHRVELLQQEIEDYYQNFK
VSNNLLELRNLVQVAELIIRCAMERKESRGLHYTLDYPDLLTTAKPTILSPV
Download sequence
Identical sequences Q47WN7
WP_011044866.1.15195 167879.CPS_4130 gi|71282357|ref|YP_270785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]