SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71278325|ref|YP_267018.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71278325|ref|YP_267018.1|
Domain Number 1 Region: 1-236,264-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.06e-21
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71278325|ref|YP_267018.1|
Sequence length 393
Comment oxidoreductase, FAD-dependent [Colwellia psychrerythraea 34H]
Sequence
MNIAIVGAGLMGRLLALSLLRGKQSESVTITLFDKDNKLAHNSAAYAAAGLLTPLGESLH
CEPNIVSMGFESLRLWPALLDSLDEYTLFQQTGAIMVSHEQDKGDYQRFVRHLNNNYPEH
KLHTLDRAQLLELEPEIGRSFNHGLYLPQEGQIGNRRLLIALRKQLEKEGMSINGVNSLN
WLSECQVFAIENTDSNSKVSYQQYGVNCSQSFDLVIDCRGTGASRKNSHSACAPLSDLRS
VRGELFQLFAPDVNISRPIRLMHPRYQLYIAPKQKGFYVVGATEIESDDDAPMTVRSAME
LLSAAYSVHPGFAEANIRQHVSQCRPTFSDNQPKITHKGSLIQVNGLFRHGFLIAPVVLK
QVLTLVDNLINNTNNELPYRDYLHTEQRQEEVI
Download sequence
Identical sequences Q48A95
167879.CPS_0251 WP_011041125.1.15195 gi|71278325|ref|YP_267018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]