SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71281737|ref|YP_268485.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71281737|ref|YP_268485.1|
Domain Number 1 Region: 425-530
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71281737|ref|YP_268485.1|
Sequence length 536
Comment sulfate permease [Colwellia psychrerythraea 34H]
Sequence
MLSLSHFNRQTIKGDIFGALTSTIVALPFALAFGVTSGAGASAGIYCAILTGLFASLFGG
TNQQISGPNTGLTVAMVAILTSFVAQSPDNGIAAAFTVVSLAGLFQMLFGIFKLGKYFIL
VSYPVISGFTSGIGVLIILSQLEPLFGHSLPELQLSLSTLTSTNTLLGLACLVILFLWPQ
RFSRIVPASIIAVTGATIFFVFSGAEMPVVGAISSELPSFNMPIWDNVLASEMIKSALLI
ATLSTLDSLMTSLTVDSITNELHDSDQELVGQGIGNIVAGLFGALPGGGATMRTVTNLRA
GGTTPLSGILHAIFILAIVLWAGEYTAYIPVAVLAAILTHVGISIIDWNFLKRLHQVPLF
SAGLMLSTLVMSVAFDLVTAVLVGVFLANLVTIRRLSEIQLDNIKLCTAKEAEHLSAPER
ELLASMDDSVLLLNISGPIGFGVARGLKQSVSESDQNKTLLIDLTDARFVGITSTIAIEE
IIVSYRNQGRDILLSSVCERVKADFDKLKLLDKISAEHVFSTRLEALTYLSEQAKS
Download sequence
Identical sequences Q484N0
gi|71281737|ref|YP_268485.1| 167879.CPS_1754 GO.9207 WP_011042579.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]