SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71282317|ref|YP_269196.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71282317|ref|YP_269196.1|
Domain Number 1 Region: 616-906
Classification Level Classification E-value
Superfamily Folate-binding domain 7.06e-95
Family Aminomethyltransferase folate-binding domain 0.0000281
Further Details:      
 
Domain Number 2 Region: 162-482
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-31
Family HI0933 N-terminal domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 908-1005
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.57e-18
Family Aminomethyltransferase beta-barrel domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71282317|ref|YP_269196.1|
Sequence length 1007
Comment sarcosine oxidase subunit alpha [Colwellia psychrerythraea 34H]
Sequence
MSQVNRIAGSSKRINRNRTLTFSFNGKEYTGFEGDTVASALLANGVDVVGRSFKYSRPRG
IITSDSQEPNAIFQIGSTQATTIPNPRATQTDLYQGLTASSTNGWPNVDFDLMGTVGKLG
GSMMPPGFYYKTFMFPQSLWMSYEHLIRKGAGLGASPQQNDPDSYDKMHHHCDVMIVGGG
PAGLAAALSAAQTGARVIISDEQNEFGGSLLCSTQQIDGQLPSQWVEKTVAQLSEMDNVM
LLPRSTVFGYYDHNLVGINERRTDHLGEHQLQSTRQRVHKVRAKQVILATGAHERPLVYG
NNDVPGCMLANAISTYINRYDVVPGKQLVLMTTNDNAYKTAIDWHQAGRKVVAIVDTRST
SNGDLVNKVKKLGIDIIFGHGVIEVKGSKRVKGVEVAPINASNHSVTGPAKHIVCDTVAS
SGGWSPVIHLSSHTGSRPVWNDDIAGFVPGDTVQKQHSCGGLEGVYALSKVISDGFTTGA
VAAEAAGKGDGRYAGNSPTTSDPQEDASMALFHIPHSKKTSRAPKQFVDYQNDVTAAGIE
LANREGFESIEHVKRYTALGFGTDQGKLGNINGMAITAKSLGKTIPETGTTIFRPMYTPT
TFGALAGADVKHLFDPARFSAMHKWHLENGAEFEDVGQWKRPWYFPQPGETMQQSLEREC
LATRNSVGILDASTLGKIDIQGKDAREFLNRVYTNPWSKLGVGKCRYGVMCKEDGMVFDD
GVTVCLDDNRFIMTTTTGGAAGVLQWLELWHQTEWPELEVYFSTVTDHWSTMTISGPNSR
KVLEKICDIDVSNDSFKYMDWRAATVAGVKARIFRISFTGELSFEINVQANYGMHAWKAV
MAAGEEFNITPYGTETMHILRAEKGFIIVGQDTDGSVTPQDLDMDWVVGKKKDFSFIGKR
SWTRFDNKRDDRKQMVGLKPKDPTFVLPEGAQIVFEKNQSIPMKMVGHVTSSYYSACMGY
SFALAVVKGGISRKGESVYLPLSDGTTVEAEICSPVFYDPKGDRQNV
Download sequence
Identical sequences Q47WX9
167879.CPS_2480 167879.CPS_4034 WP_011043290.1.15195 gi|71280977|ref|YP_270692.1| gi|71282317|ref|YP_269196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]