SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50954127|ref|YP_061415.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50954127|ref|YP_061415.1|
Domain Number 1 Region: 4-485
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.09e-195
Family Heme-dependent catalases 0.0000000000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50954127|ref|YP_061415.1|
Sequence length 497
Comment catalase [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MSENHTTTQTGTPVASDAHSLTAGQDGATALHDRYLVEKLAQFNRERIPERIVHAKGGGA
FGTFAVTGDVTAYTKAAVFQPGAKTETVQRFSSVAGEQGSPDTWRDVRGFSVKFYTSEGN
YDIVGNNTPVFFIRDGMKFPDFIHSQKRLPGSGLRDADMQWDFWTLSPESAHQVTYLMGD
RGLPRSWRTMPGYGSHTYQWINAAGERFWVKYHFHALHGNEEMHGAEAEKIAGEDADYYR
RDLYEAIERGDFPAWKLSVQVMPYEDAKTYRLNPFDLTKVWPHSDYPLIEVGVHTLNRNP
ENFFAQIEQAAFSPANTVPGIDISPDKMLTARVFSYPDAQRYRVGTNYNELPVNAPVAPV
HNYSQDGAARHGFKAAEAPVYAPNSFGGPVADPALAGEGSWESDGALVRAAATLHAEDDD
FGQAGSLYRDVFDAKAKERFLDTIAGAVGGVQRDDIRERAIQYWTSVDAGLGGLLRTRLA
SGVTDADEAAEFVGVAG
Download sequence
Identical sequences A0A1E2SJ46 Q6AH35
gi|50954127|ref|YP_061415.1| 281090.Lxx02780 WP_011185313.1.68452 WP_011185313.1.84704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]