SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50954413|ref|YP_061701.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50954413|ref|YP_061701.1|
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily CsrA-like 3.01e-18
Family CsrA-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50954413|ref|YP_061701.1|
Sequence length 85
Comment carbon storage regulator CsrA [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MLVLTRKQGEKILIGDDIEITVLDTRGDGIRIGISAPRGIRIQRDEVRKAIEAENRSAAM
RNPAAEFELIASLTALQNAEDPPPR
Download sequence
Identical sequences A0A1E2SL11 Q6AG99
WP_011185595.1.68452 WP_011185595.1.84704 281090.Lxx06470 gi|50954413|ref|YP_061701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]