SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50954785|ref|YP_062073.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50954785|ref|YP_062073.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Formyltransferase 5.49e-47
Family Formyltransferase 0.00000906
Further Details:      
 
Domain Number 2 Region: 204-293
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.3e-23
Family Post formyltransferase domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50954785|ref|YP_062073.1|
Sequence length 302
Comment methionyl-tRNA formyltransferase [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MRLVFAGTPAVAVPSLTALAARFEVAAVITREDAPLGRKRILTPSPVAIAAEELGLSVIR
ANRLREEAIERVRVLRPDVGVVVAYGGLVHEPLLSLPRRGWVNLHFSLLPRWRGAAPVQH
ALIAGDRETGAAVFQLVPELDAGDVFGELRRLIRPDETAGELLDDLARSGARLLADTVAA
LADGTAVATPQSGEPVAAPKLGIADAKLDLTRPADEVYARFRGVTPEPGAWALLDGERFK
IHAVRPTAAGVLPPGAVVADGKRILAGTGSRPLELVTVQPAGKRVMAAADWWRGAGGEAV
LS
Download sequence
Identical sequences A0A1E2SKS1 Q6AF77
281090.Lxx11170 WP_011185964.1.68452 WP_011185964.1.84704 gi|50954785|ref|YP_062073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]