SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50955477|ref|YP_062765.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50955477|ref|YP_062765.1|
Domain Number 1 Region: 93-289
Classification Level Classification E-value
Superfamily Formyltransferase 7.85e-59
Family Formyltransferase 0.00016
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000217
Family Glycine cleavage system transcriptional repressor 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50955477|ref|YP_062765.1|
Sequence length 290
Comment formyletrahydrofolate deformylase [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MDSPAPATHPNHWVLTFSCADRPGIVHAVSGAIVAARGNITESQQFASTDTGRFFMRLQV
ESAADREEFERALAPIVTQFGMSHRVDNVGRPLRTLVLVSTAAHCLNDLLFRQRAGHLPV
EIPLVLSNHGTLRDLAGFYGVPFESAPVTDPASKAAFEERTLAAVEEHGIELVVLARYMQ
ILSPELCERLAGRAINIHHSFLPGFKGANPYRQAHARGVKLIGATAHFVTSDLDEGPIIE
QNVVRVDHASSVPELVAIGQDEESRTLTQAVKWFAEDRVLLDGARTIIFR
Download sequence
Identical sequences A0A1E2SNP8 Q6AD84
gi|50955477|ref|YP_062765.1| WP_011186647.1.68452 WP_011186647.1.84704 281090.Lxx19400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]