SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50955533|ref|YP_062821.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50955533|ref|YP_062821.1|
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.28e-41
Family Phosphoglucomutase, first 3 domains 0.00058
Further Details:      
 
Domain Number 2 Region: 263-371
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.89e-31
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 
Domain Number 3 Region: 163-261
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.65e-24
Family Phosphoglucomutase, first 3 domains 0.0015
Further Details:      
 
Domain Number 4 Region: 363-451
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.42e-24
Family Phosphoglucomutase, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50955533|ref|YP_062821.1|
Sequence length 453
Comment phosphoglucosamine mutase [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MPRLFGTDGVRGLANGTLTADLALGLAQAAAAVLTRGRSAEARRAVGKRPLAIVARDPRV
SGEFLSAAVAAGLASSGIDVYDAGVIPTPAAAFLIADFDADFGVMVSASHNPAPDNGIKI
FARGGTKLPDVVEDRIEEHLHLEKLTPTGAEVGRIQCFADAEDRYVLHLLASLPHRLDGI
HVVLDCAHGAAAGISPEVFTDAGARVTVIGDAPDGMNINDGVGSTHLDRLAEAVLAAGAD
VGIAHDGDADRCLAIDASGRTVDGDQIMAILALGMKERGKLRDDTLVATVMSNLGLKLAM
REAGVRVVETAVGDRYVLEEMNGHGYSLGGEQSGHVIMSDFATTGDGILTGLHLLSEMAR
QRKTLAELAQAMTVYPQVMVNVRGVDHHSVHSDELLRSAVEAVEAALGDSGRVLLRPSGT
EPLVRVMVEAADQETAVRMANELADVVRERLAG
Download sequence
Identical sequences A0A1E2SMV8 Q6AD28
gi|50955533|ref|YP_062821.1| WP_011186702.1.68452 WP_011186702.1.84704 281090.Lxx20010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]