SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50955868|ref|YP_063156.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|50955868|ref|YP_063156.1|
Domain Number - Region: 157-270
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00628
Family Phase 1 flagellin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50955868|ref|YP_063156.1|
Sequence length 280
Comment hypothetical protein Lxx24170 [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MNTLADYQVEFNGFLMGPGTAYDLPPGCDFFDMAAIKTMDQQRVWADGSWSGPDFAGVLT
PTLPMNAHATQAVTLTDALSALRGVLSPQATAGPLWVKLPGMVAQGIPAKVAKRSFPLGL
EWYAGSASGAVQFRCPDPAWQSVPRILQLAASGAASSGLSFPLFQAVSTVLDFGVTGLSS
AAGTLTNAGNTPAFPYVVVTGPVSGFSIVIDGNTVTYTDTVAAGQTLTIDYRTGYATLTG
GVDRTTRLSSRQFSAVTSTSSVFFSAAAGVAAITIADLWR
Download sequence
Identical sequences Q6AC41
gi|50955868|ref|YP_063156.1| 281090.Lxx24170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]