SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50955287|ref|YP_062575.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50955287|ref|YP_062575.1|
Domain Number 1 Region: 16-127
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.000000000536
Family ADP-ribosylglycohydrolase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50955287|ref|YP_062575.1|
Sequence length 129
Comment hypothetical protein Lxx17080, partial [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MPPFLPDWRTARPIAPYHKGDGHVTDDTLMTTALVDVYDTVRDHLDAYAIADHLVPLLIG
EKRWIPEFESEGLLLHRIFLAEKWLVARLHYGHIDPREAGVGNIVNCGATMYVAPIGIVN
AGNPESAYA
Download sequence
Identical sequences Q6ADS6
281090.Lxx17080 gi|50955287|ref|YP_062575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]