SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LELT_04887 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_04887
Domain Number 1 Region: 269-343
Classification Level Classification E-value
Superfamily E set domains 0.000000182
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_04887
Sequence length 1176
Comment | LELG_04887 | Lodderomyces elongisporus conserved hypothetical protein (1177 aa)
Sequence
MSNHYSQNRKHNNQQELLPPSSPLFPALQLTNQLPHNTNIFTPTLPDKPTCSTSSLSVYI
IPSEQNLFVQGFDPREYISRPPTILRGTLFIRVIKPTKIKSISLSFRGVQRTEWPEGIPP
KKNSYAEVNDVINHTWPFFQTPSAGGSSSSSGNATATATAATASSTSFSSPHNGADFYIE
RNGANRSGLNDETSASNVNVAAAAAAAARSPSPAPRRSAGTSTSLNSTESSGNFLLRNLS
PSFLRRSKSPSIGSLDAAALGELTTVTSPSSDPQSQMHFAPGDYLYNFEHPLPPSIPESC
NVTFGSTAYNLEVSIQRPGTFKSNLSGKLPINIIRTPSELNMEENESIVISRDWEDQIKY
DIVIGAKSVVLNSYLPLAFRFVPLWGKVALHRIRIYLTENLEYYCNNKKVHRMEPPKKFL
LLEHKARKGRSLLQTNPHDESEVGLDQYDEDVLPKELEFQLYVPKDITGRGLTQIHPDTS
YENIQAHHWIKICLRISKQDPENPQKRKHYEISIDSPLHVLSPLAAHGNTLLPAYDDLID
SNNNTHTPASVADNILSPGVTPVDYHHNHHSHHSHHSSNEPTPEASSSSTTAIRSMLNNN
RRSSSPGNRPVIPDPDTLSPARSIEFHHIKSELNLAGLAGETEANMHLDANLYKPETEET
ISTINSPQARPHDGTFTSPLNSPIQRPIHLIRKPSIAPPPFDEAAKDPKMSLHPPAYQER
DEGSLSLSPLRIDDTNDASFANPLNPSSSSKGISSLNAQSNTPVRDLLIQQLNGSRSELA
QDTQTQQSSASPITENNSSTLPQITIDASDSSHEEQSIAKKENKTENKISAPAKTEEKDL
ADDEFLPVSPSLPAIGSCSRRNRERTSTDGSSDKMSPSPRRTSNAQAEYNNNKTRKNSTA
DNQDMHSSSNSRSRASSISSISSEQTPLDQTMPLLNQSTSSIATHNAFFNSGSNMYATET
NQSIGSSIYDLAYRRPSQVGTKPAGVFMSALGNDIAEDEFRGFNSLHHLRNPRIGKHYQN
FDNDNDNDAGMSTGTGTGTGTSTGTGTGTGNTSDSLAILPDKTGVATTNTNLFTLDNRLV
THNAVPEEIIDEEEASEESGLTLDEVHLHQIQSQVPKESKDRGVDSGVGADAGAGADVNV
GAGNDGDKMNNWHQHGPPHSGAMEEVPAYKMGYIIE
Download sequence
Identical sequences A5E5J8
LELT_04887 36914.A5E5J8 XP_001524074.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]