SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389873858|ref|YP_006381277.1| from Advenella kashmirensis WT001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389873858|ref|YP_006381277.1|
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000314
Family Rob transcription factor, C-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389873858|ref|YP_006381277.1|
Sequence length 164
Comment hypothetical protein TKWG_23510 [Advenella kashmirensis WT001]
Sequence
MHTVNLPSFRIFGIQTRTRNADEETLKTARLPLLWHDVYTELVPELPADAPIYGVYGEYE
SDQDGRYTVTAGADQKPKKCNLDLVEVTVPSGQYLVFSGKGKMPETVIRVWLDIWDYFKR
EDTPHQRAYTTDFEIYRGARKGRLKSVCISPSNKSSRYRLAGWA
Download sequence
Identical sequences I3UH07
WP_014752386.1.62074 gi|389873858|ref|YP_006381277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]