SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SS1T_06214 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_06214
Domain Number 1 Region: 10-170
Classification Level Classification E-value
Superfamily CinA-like 4.58e-37
Family CinA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SS1T_06214
Sequence length 176
Comment | SS1G_06214 | Sclerotinia sclerotiorum conserved hypothetical protein (177 aa)
Sequence
MSEANDFPPQKVREVLSEVVGLLKERGETVSVAETAAGGIISASILSTPGASKIYKGGLT
VYTLEARTAFTGWTQETIKAYTGPTPDVVAGIAEDVRPKLGSTYCICESGTAGPNPSGEG
PNKQPGYVALAIATEKGTYKKDLNTGLGGDREGNMIVFAREALAFLRDVLRGDAKI
Download sequence
Identical sequences A0A1D9Q406 A7ELL7
XP_001593292.1.14510 SS1T_06214 665079.A7ELL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]