SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SS1T_00208 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_00208
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily ITPase-like 1.26e-22
Family ITPase (Ham1) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SS1T_00208
Sequence length 83
Comment | SS1G_00208 | Sclerotinia sclerotiorum hypothetical protein similar to non-canonical purine NTP pyrophosphatase (84 aa)
Sequence
MAPPKTLNFITGNKNKLIEVKAILGDTIDLQSQSLDLVEIQGTIEEISSDKCRRAAEIIK
GPVLVEDTCLCFNALKELPGPYM
Download sequence
Identical sequences A7E4I6
XP_001598122.1.14510 665079.A7E4I6 SS1T_00208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]