SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SS1T_02408 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_02408
Domain Number 1 Region: 130-215
Classification Level Classification E-value
Superfamily S13-like H2TH domain 7.72e-23
Family Middle domain of MutM-like DNA repair proteins 0.0041
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000114
Family N-terminal domain of MutM-like DNA repair proteins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SS1T_02408
Sequence length 389
Comment | SS1G_02408 | Sclerotinia sclerotiorum hypothetical protein similar to AtMMH-1 (390 aa)
Sequence
MPEIAEVARAVHHIRKNLVGKTLAIVKAQDDANVFGKVGTSAAEFQKALTGKKVDDYVLA
ATSGISLRHDGSKDEGEKEVWPPKFSKFSLQTAEEPKVDAAFTDSRRFSRIRLVDCVAGA
IRNTTPLKENGPDPVIDKDILTAEWLEQKLNKKQVPIKALLLDQANISGIGNWVGDEILY
RARLHPEQYSNTFSSEEIKRLHASMMYICQTAVDLLADSSKFPDDWMFKHRWGKGKKDGP
TALPNGEKITFLTVGGRTSCVVPSVQKKTGPVAGDIKKGNGSGDGMTSEDIPVKKQSSRK
RKAAMVSTNFEEFDEDATDPKKSKAKAQKSTQVKEKISGDGAGNIATKAVKLTKRKTSKS
TESKAMEGIAPVQPRRRSGRHVKTDGVQD
Download sequence
Identical sequences A7EAS6
XP_001596192.1.14510 SS1T_02408 665079.A7EAS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]