SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SS1T_04585 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_04585
Domain Number 1 Region: 4-170,197-401
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.81e-100
Family IF2B-like 0.000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SS1T_04585
Sequence length 445
Comment | SS1G_04585 | Sclerotinia sclerotiorum methylthioribose-1-phosphate isomerase (446 aa)
Sequence
MAGLEAIKYGRGRLEVLDQLRLPHEFVYDNVSTCEEAFDSIKSMRVRGAPAIAIVAALAL
AVELHHEKDGSKTKQEAVQYINKRLDYLLGSRPTAVDLSNAIKLLKRVSQSAAEATNALD
DSAACADVRKGYIDAAEKILEDDLTTNLAIGRYGAEYLRRQQMPIGGEEDDEDPSKFFTT
SPPCTQGAPDRTYRKLSVLTHCNTGSLATSGHGTALGIIRSLHKMNYLDHAYCTETRPYN
QGSRLTAFELVYEKIPSTLITDSMAGALFARMKESKNISAVIVGADRVARNGDTANKIGT
YSLAVLAKAHNIKFIVAAPTTSIDLETVSGADIKIEDRAPTELTQISGAVVGKDGHVDVN
TTARVAIAHQGIDVWNPSFDVTPSMYIDAVITEKGEVVRSSKGTFDFKTIMPERWAQQVE
GKELSAETNVKAHVDDGTQFPMENI
Download sequence
Identical sequences A0A1D9PVQ6 A7EGZ3
665079.A7EGZ3 XP_001594777.1.14510 SS1T_04585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]