SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SS1T_10541 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_10541
Domain Number 1 Region: 10-84,182-401
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.85e-62
Family IF2B-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SS1T_10541
Sequence length 421
Comment | SS1G_10541 | Sclerotinia sclerotiorum translation initiation factor eIF-2B subunit beta (422 aa)
Sequence
MAPVQSGGLLKRRQIRTPRSCAIATAHLLLQVVAKQRWTDITKVLERIRKVGQRLIEAQP
REMVVGNIVRRVLGMIRDEAKEDRTEDVSDSASTSQIGSPRREGFSDVGLSRLTQSSRPP
LMTSHTSYAAQHNVPVQQSMFNLLSAAPSPASTPPGTSSPHGRSVLDMTSLANKMASTTR
DLKAEIINGIEEIIDELDQVDDQISSYAQEQISEREVILTHGTSRSVQKFLLKAAEKRKF
TVVVAESYPNDHSTTHSTVTGTAEQDTEGDLSTKTFLKPLSAAGIIVTLITDAAVFAVMP
RITKVILATHTVIANGGLVAAAGARIIARAAKFHRIPVIVVSGIYKLSPEYPFEFESLIE
YGDPGNVVGFEDGEFVDKVEIDNPLFDYVSPDLVELYITNLIVAEHYKPEDINFHKPELQ
F
Download sequence
Identical sequences A7EYX5
665079.A7EYX5 XP_001588095.1.14510 SS1T_10541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]