SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47459335|ref|YP_016197.1| from Mycoplasma mobile 163K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47459335|ref|YP_016197.1|
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.000000000157
Family Glucose permease domain IIB 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47459335|ref|YP_016197.1|
Sequence length 122
Comment putative glucose/sucrose specific PTS system IIB component [Mycoplasma mobile 163K]
Sequence
MSKKDKFLYIFLIIITFGLILLYWRKYRQIKPKKELSISTKISFKLEDLIDSLGSKENIK
SIKSSNQIVKIAINDNSLVKIDEVKNLKGISGVVNNTTQISLVVGNSAPTIQKELENKLQ
KS
Download sequence
Identical sequences Q6KHE4
267748.MMOB5000 gi|47459335|ref|YP_016197.1| WP_011265020.1.31918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]