SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47459438|ref|YP_016300.1| from Mycoplasma mobile 163K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47459438|ref|YP_016300.1|
Domain Number 1 Region: 47-204
Classification Level Classification E-value
Superfamily PEBP-like 1.96e-20
Family Prokaryotic PEBP-like proteins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47459438|ref|YP_016300.1|
Sequence length 456
Comment phospholipid binding lipoprotein [Mycoplasma mobile 163K]
Sequence
MKMKKNTKILISSSAAISALGIIPAAVIACGTTTETTESITSTSIVNGVLGKKFGAANDN
GPLRAETPQLSFKSVTGATSYALVILDNEATNVIGVPFIHWAIANIKIKADANGMINIPE
NIASEANAAARALITQGRNSSFMNANSAIPGGFQRPDSVGYFSPFPPNAGHYYQISVLAL
DKEVTGLAEGFTLADLYSGIQTQGIKIVDRKYGDFFYNQVVQRQGSDSLFEHPANSLTTA
PRLYRGVVPNIANIASTSVTNGNLQANFFNARTNGVNATADTLGQNSTIPNLSWNAVSGA
NSYLVTISNYSFSNINQAPFTNFVAVVPAEANTTNNKVTLPSQLANANSTNGVIYGKNSS
STDNVIATGGASLINVMLKQNANYFMPQGRANWIIVVNVYALKSNITTASGTNPVLTNGS
HFLNEFTTRAANRDGIIAAGEFVFNLPGSGTTNATI
Download sequence
Identical sequences Q6KH42
267748.MMOB6030 gi|47459438|ref|YP_016300.1| WP_011265123.1.31918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]