SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47459441|ref|YP_016303.1| from Mycoplasma mobile 163K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47459441|ref|YP_016303.1|
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.7e-32
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0016
Further Details:      
 
Domain Number 2 Region: 174-272
Classification Level Classification E-value
Superfamily PTS system IIB component-like 4.19e-30
Family PTS system, Fructose specific IIB subunit-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47459441|ref|YP_016303.1|
Sequence length 725
Comment PTS system fructose specific IIABC component [Mycoplasma mobile 163K]
Sequence
MMLKDMFRQNLIFINEELNDKKEVIKFISNKLAENDYASNSEILYNEFNQREEEISTGIG
NKIAIPHIRNELMKENVIVFIKNKGIDWNSLDNLEVEYIFAIAITKKDEENNLHLLTLQK
LANLFSNLDFKNNLAKINSSEEFLDLVSLYEDKLNKEAIEIKEKNYKKKEDEYILAITSC
PTGIAHTYLAAQKLKKAGKKLGINLKVETQGANGIENKISSEEIQKAKGLILAIDRNIET
IRFKNLDNIIETSTSKAIKNSEELIKEILAKKGTKLQNITGKINENNNTDDNEEFTLKNF
GKKSYKALLTGISYMLPFVVFGGIMIAIGFLIDSFAGAPAGNDFGKTHVVAHWFNSLGGI
SFSVFIAILAAYISFAIVGRVGLLPGFVVGFISTGAFNPVYVRIFNIPLFASSSSGFFGA
IVGSFFSAFMIIIFMKYVLHKFPKSLNGIKQIIIVPFFGTLIIASLFVIINIPLLYLNFG
FSQFLNLFTGRIELAWLLGLIAGIMMGVDLGGPINKAAYVFAVSTLSIATQGQSQVMAAV
MAAGMVPPIMLALSTLINHKIWSKEERIESQANWIFGFSFISEGAIPLTAKYPKRLVLAN
LISAGLTGMISSLLGVTIAAPHGGIFVAPLLRTTLISNLNLGLIIFIAFIFWMLAIFIGA
LAGVLVIWLMHKYNKNQPTKERKYCLIKYAKSKLRSSKKQEKFNVQKIRWQDVKIHKLNE
VFKKI
Download sequence
Identical sequences Q6KH39
267748.MMOB6060 WP_011265126.1.31918 gi|47459441|ref|YP_016303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]