SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390952812|ref|YP_006416570.1| from Aequorivita sublithincola DSM 14238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390952812|ref|YP_006416570.1|
Domain Number 1 Region: 355-547
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-55
Family Pyruvate oxidase and decarboxylase PP module 0.0002
Further Details:      
 
Domain Number 2 Region: 1-169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.4e-46
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000444
Further Details:      
 
Domain Number 3 Region: 153-342
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.83e-37
Family Pyruvate oxidase and decarboxylase, middle domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390952812|ref|YP_006416570.1|
Sequence length 582
Comment thiamine pyrophosphate-dependent protein [Aequorivita sublithincola DSM 14238]
Sequence
MNVSEQILQILKNVGVTQIWGVTGDALNTFTDALRDDDDMKWIAVRHEENGAFAAGAEAQ
MTDNLAVCAGTVGPGTLHLINGLYNAKKERVPVLAISGQVARVNMGTNYFQEVGLTKIFD
DVCAYQAIIRSAEEAPRVVLKAIQIALEQRAVVRVEIPVDIAVEEAKGAHFEHPVFRGNA
VLVPSEKDINKIANAINEAEKITILAGAGCRNSREEVLALSEKLKAPIVHTFRSSDVIHN
DDKNVVGLTGLIGNPSAYHAVMKPDLLLMLGTDFPYSNFLPDDVKIIQVDKRIENIGNRV
KVDIGVQGDCLATLEKLEAKILPKKNSEFLDNLVENFKKWKQHKLESSSLKMDEEPLHPQ
LFMNVINKKASDDACFTVDVGESAIWVAHHLSFRGKRRLLGSFNHGSMAVGFPAAMGIQS
VNPGRQVWAIVGDGAFGMCMNDFITAVRYNWPVKILVYNNSQLGFVKIEMEEAGYAMADE
ALGLQNPNFAEYAKLCGGNGIRVEHAADIEKAIEMAIASPKPFIIDAVTNPGELSLPPNI
TLEEAWGFGKSKVKEILLSVQGDKNQKNNLMDEIKGFFHNSK
Download sequence
Identical sequences I3YRD7
gi|390952812|ref|YP_006416570.1| WP_014780813.1.66925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]